DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG30323

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:230 Identity:44/230 - (19%)
Similarity:68/230 - (29%) Gaps:112/230 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDI 124
            |.:|.||::...||:|:..|              :.|:|:.|         .:...|..||.   
  Fly    51 NHFCAGSLLSAWWVVTSGCC--------------VSTRPEST---------PNQPSNRKNLR--- 89

  Fly   125 SLIRTPHVDFWSLVNKVELPSYNDRY-----------------------------QDYA------ 154
            .::.||        .:::.||..:.|                             |.:|      
  Fly    90 VVVFTP--------KRLKKPSPKNIYHVQKIVLDESAISGCTELALLKLDRGVTGQRFAMMLPEK 146

  Fly   155 ----GWWAVASGWGGTY--------------------------DGSPLPDWLQSVDVQIISQ--- 186
                .|...:.|||..|                          || |....|..:..|.||:   
  Fly   147 ELNSTWLCNSLGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDG-PYSSELIQIRAQKISEYEC 210

  Fly   187 -SDCSRTWSLHDNMICINTDGGK-STCGGDSGGPL 219
             .||||       .:|:.:..|: :.|..|.|.||
  Fly   211 KPDCSR-------CLCMTSYTGRGNMCQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 44/230 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 44/230 (19%)
Tryp_SPc 45..272 CDD:214473 44/230 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.