Sequence 1: | NP_524554.1 | Gene: | Jon99Cii / 43544 | FlyBaseID: | FBgn0003356 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_725729.2 | Gene: | CG30323 / 246539 | FlyBaseID: | FBgn0050323 | Length: | 306 | Species: | Drosophila melanogaster |
Alignment Length: | 230 | Identity: | 44/230 - (19%) |
---|---|---|---|
Similarity: | 68/230 - (29%) | Gaps: | 112/230 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 NWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDI 124
Fly 125 SLIRTPHVDFWSLVNKVELPSYNDRY-----------------------------QDYA------ 154
Fly 155 ----GWWAVASGWGGTY--------------------------DGSPLPDWLQSVDVQIISQ--- 186
Fly 187 -SDCSRTWSLHDNMICINTDGGK-STCGGDSGGPL 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon99Cii | NP_524554.1 | Tryp_SPc | 36..260 | CDD:238113 | 44/230 (19%) |
CG30323 | NP_725729.2 | Tryp_SPc | 45..275 | CDD:304450 | 44/230 (19%) |
Tryp_SPc | 45..272 | CDD:214473 | 44/230 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45471250 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |