DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG30098

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:241 Identity:62/241 - (25%)
Similarity:103/241 - (42%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA--SIRTQ 97
            |:..|..|  .:.|::..|:  .:..:.||||:|...:||||||||.....:.:..|.  |.||.
  Fly    36 RVIGGQNA--RRTPWMAYLI--RDNRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTT 96

  Fly    98 PQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPHVDFWS--------LVNKVELPSYNDRYQDYA 154
            ...|.......|.:|.:|.....| ||::::......:.        |:|. .|.|..:..|:: 
  Fly    97 DGQTRSYRVVSIYRHKNYIDFRNH-DIAVLKLDRQVVYDAYIRPICILLNS-GLQSLANSIQNF- 158

  Fly   155 GWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWSLHDNMICINTDGGKSTCGGDSGGPL 219
                ..:|||.......:|..||.:.::.:....|. ..||  ::.|.|.  .:..|.|||||||
  Fly   159 ----TLTGWGQMAHYYKMPTTLQEMSLRRVRNEYCG-VPSL--SICCWNP--VQYACFGDSGGPL 214

  Fly   220 --VTHDGNRLV----GVTS--FGSAAGCQSGAPAVFSRVTGYLDWI 257
              :...|::.:    |||:  .|:..|..|     :..:..|:.|:
  Fly   215 GSLVKYGHKTIYVQFGVTNSVTGNCDGYSS-----YLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 61/240 (25%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 61/238 (26%)
Tryp_SPc 37..258 CDD:238113 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.