DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG30088

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:286 Identity:78/286 - (27%)
Similarity:121/286 - (42%) Gaps:54/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLALAVAAATAVPAPAQKLTP----TPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 65
            :::.:.|.........|..|.|    :...::..||..|..|.....|::..|.:|...:  |||
  Fly    10 IYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIH--CGG 72

  Fly    66 SIIGNTWVLTAAHCTN-------GASGVTIN---YGASIRTQPQYTHWVGSGDIIQHHHYNSGN- 119
            :||.:.::||||||..       |...:|.|   .|.|.....:      ..||:....|...: 
  Fly    73 TIISSRYILTAAHCMRPYLKVRLGEHDITRNPDCQGGSCSPPAE------EFDIVLATKYKRFDR 131

  Fly   120 -LHNDISLIR-------TPHVD-FWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDW 175
             |.|||:|::       ..|:. ...::|....|:.:: :|        |.|||.| :.:...:.
  Fly   132 FLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE-FQ--------AFGWGQT-ETNHSANV 186

  Fly   176 LQSVDVQIISQSDCSRTWS--LHDNMICINTDGGKSTCGGDSGGPLVT---HDG---NRLVGVTS 232
            ||:..:.......|....|  :..|.:|:... |..||.|||||||||   :||   ...:|:.|
  Fly   187 LQTTVLTRYDNRHCRSVLSMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVS 250

  Fly   233 FGSAAGCQSGAPAVFSRVTGYLDWIR 258
            ||... |||  |.|::.|..|:.|||
  Fly   251 FGDDK-CQS--PGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 73/251 (29%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 71/249 (29%)
Tryp_SPc 45..273 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.