DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Cela3a

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:287 Identity:81/287 - (28%)
Similarity:125/287 - (43%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSIIGNT 71
            |.||.|:....|:.  .|:      .|:.||..|.....|:.|.|.:...|::  .||||:|...
Mouse     9 LLVALASGCGQPSH--NPS------SRVVNGEEAVPHSWPWQVSLQYEMGGSFHHTCGGSLITPD 65

  Fly    72 WVLTAAHCTNGASGVTINYGASIRTQPQYTHWV----------GSGDIIQHHHYNSG--NLHNDI 124
            |||||.||..    ..:||...:   .::.|.|          .:|::..|..:||.  |..|:|
Mouse    66 WVLTAGHCIM----PYLNYRVVL---GEHEHGVEEGSEQVIPINAGELFVHPKWNSECVNCGNNI 123

  Fly   125 SLIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSD 188
            :|:: :........|....||...:...:.|..:  .||||......|||..||...:.::....
Mouse   124 ALVKLSRSAQLGDAVQLACLPPAGEILPNGAPCY--ISGWGRLSTNGPLPTKLQQALLPVVDYEH 186

  Fly   189 CSR-TWSLH---DNMIC---------INTDGGK----STCGGDSGGPLVTHDGN---RLVGVTSF 233
            ||| .|..|   ..|:|         :::|..:    |...|||||||.....|   ::.|:.||
Mouse   187 CSRWDWWGHYVKRTMVCAGGYIQAHSLSSDTHQPRLLSPLQGDSGGPLNCPADNGTWQVHGIASF 251

  Fly   234 GSAAGCQS-GAPAVFSRVTGYLDWIRD 259
            .|.:||.: ..|.:|:||:.::|||.:
Mouse   252 VSPSGCNTLKKPTMFTRVSAFIDWIEE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 74/260 (28%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 73/257 (28%)
Tryp_SPc 28..279 CDD:238113 74/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.