DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and try-5

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:302 Identity:66/302 - (21%)
Similarity:111/302 - (36%) Gaps:83/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAATAVPAPAQKL-------TPTPIKDIQGRITNGYPAYEGKVPYIVGLLF---SG 57
            :|:|..|.|...|.:.....:|       |...:.|..|  ..|.|.:  ..|:.|.:..   .|
 Worm     7 VFLFQVLVVIKGTKLKYYNDELCGRQSTYTSFMLTDAAG--NTGNPTH--LAPWAVQIRVKARKG 67

  Fly    58 NGNWWCGGSIIGNTWVLTAAHC-------------TNGASG-----------------VTINYGA 92
            :....|||::|....|||||||             .|..||                 ..:..||
 Worm    68 DFEVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGA 132

  Fly    93 -SIRTQPQY--THWVGSGDIIQHHHYNSGNLH-------NDISLIRTPHVDFWSLVNKVE----- 142
             ..|.:.:|  .:...:|..::...:..|:.:       |||.::     :..|.::.||     
 Worm   133 MCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVIL-----ELESTIDDVEGANYA 192

  Fly   143 ----LPSYNDRYQDYAGWWAVASGWGGT----YDGSPLPDWLQSVDVQIISQSDCSRTW--SLHD 197
                ||..|.:    :|....:.|||..    :|.:..| .:|.:.:...:.:.|...|  |:..
 Worm   193 CLPFLPEVNIQ----SGANVTSFGWGSDPGKGFDNAAFP-MIQVLTLATETLATCEENWGTSIPF 252

  Fly   198 NMICINTDGGKSTCGGDSGGPLVTHDGNR----LVGVTSFGS 235
            :..|...:..|:.|.|||||.|..|..:.    ::.:.|:||
 Worm   253 DSFCTAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 57/262 (22%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 57/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.