DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CTRL

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:259 Identity:93/259 - (35%)
Similarity:135/259 - (52%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGAS 84
            ||.|    |......||.||..|..|..|:.|.|..| :|..:||||:|..:||:||||| |.:.
Human    22 PAIK----PALSFSQRIVNGENAVLGSWPWQVSLQDS-SGFHFCGGSLISQSWVVTAAHC-NVSP 80

  Fly    85 G----VTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR--TPHVDFWSLVNKVEL 143
            |    |...|..|...:|.....|...  |.|..:||..::||::|::  :| ..:.:.::.|.|
Human    81 GRHFVVLGEYDRSSNAEPLQVLSVSRA--ITHPSWNSTTMNNDVTLLKLASP-AQYTTRISPVCL 142

  Fly   144 PSYNDRYQDYAGWWAVASGWG---GTYDGSPLPDWLQSVDVQIISQSDCSRTW--SLHDNMICIN 203
            .|.|:...:  |...|.:|||   |.  |:..|..||.|.:.:::.:.|.:.|  |:.|:|||..
Human   143 ASSNEALTE--GLTCVTTGWGRLSGV--GNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAG 203

  Fly   204 TDGGKSTCGGDSGGPLVTHDGNR--LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNTGISY 265
             ..|.|:|.||||||||...||.  |:|:.|:|: ..|...||||::||:.:..||  |..|:|
Human   204 -GAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGT-KNCNVRAPAVYTRVSKFSTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 85/236 (36%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 86/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.