DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG43742

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:268 Identity:82/268 - (30%)
Similarity:123/268 - (45%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGN 70
            |..|.||......|.||.|.......|..|:.||:.|...:   .:..|:: |..::||||:|..
  Fly     5 FSLLLVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQ---FMAALYN-NSEFFCGGSLIHK 65

  Fly    71 TWVLTAAHCTNGASGVTINYGASIRT--QPQYTHWVG-SGDIIQHHHYNSGNLHNDISLIR---- 128
            .:|||||||......||::.|.:.|:  .|...|.:. :..:|.|.:::.....|||:|:|    
  Fly    66 QYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLERE 130

  Fly   129 ---TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCS 190
               ..|:....::...::.|.|...       ..|.|||.|..|: :.|.|..:|:..:.:|.|.
  Fly   131 VIFEAHIRPICIILDEDVTSNNQNN-------FTAYGWGKTEHGN-ISDVLSFIDLVRLPKSMCY 187

  Fly   191 RTWSLHDNMICINTDGGKSTCGGDSGGPLV---THDGNR---LVGVTSFGSAAGCQSGAPAVFSR 249
            :    :.|.||..:..| .||..||||||:   .|.|..   |.|:||:|.|. | ||...|::.
  Fly   188 Q----NINTICAGSTSG-DTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAE-C-SGLFGVYTD 245

  Fly   250 VTGYLDWI 257
            |..|..||
  Fly   246 VNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 72/238 (30%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 71/237 (30%)
Tryp_SPc 35..256 CDD:238113 72/238 (30%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.