DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and F9

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:257 Identity:70/257 - (27%)
Similarity:121/257 - (47%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA------- 92
            |:..|..|..|::|:.|  :.:|....:|||:||...|::|||||......:.:..|.       
Mouse   236 RVVGGENAKPGQIPWQV--ILNGEIEAFCGGAIINEKWIVTAAHCLKPGDKIEVVAGEYNIDKKE 298

  Fly    93 -------SIRTQPQYTHWVGSGDIIQHHHYNS--GNLHNDISLIRTPHVDFWSLVNKVELP---- 144
                   .|||.|             ||.||:  ....:||:|:   .:|...::|....|    
Mouse   299 DTEQRRNVIRTIP-------------HHQYNATINKYSHDIALL---ELDKPLILNSYVTPICVA 347

  Fly   145 --SYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC--SRTWSLHDNMICIN-T 204
              .|.:.:..:...:  .||||..::.......||.:.|.::.::.|  |.|:::::||.|.. .
Mouse   348 NREYTNIFLKFGSGY--VSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTTFTIYNNMFCAGYR 410

  Fly   205 DGGKSTCGGDSGGPLVTH-DGNR-LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNTGIS 264
            :|||.:|.||||||.||. :|.. |.|:.|:|... ...|...::::|:.|::||::.|.::
Mouse   411 EGGKDSCEGDSGGPHVTEVEGTSFLTGIISWGEEC-AMKGKYGIYTKVSRYVNWIKEKTKLT 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 68/250 (27%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 67/248 (27%)
Tryp_SPc 237..467 CDD:238113 68/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.