DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CTRC

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:171 Identity:47/171 - (27%)
Similarity:78/171 - (45%) Gaps:17/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSIIGNT 71
            ||.|::..||:    ..|    ::..|:..|..|.....|:.:.|.:..|..|  .|||::|.:.
Human    11 LACASSCGVPS----FPP----NLSARVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASN 67

  Fly    72 WVLTAAHCTNGASGVTINYGA-SIRTQPQY-THWVGSGDIIQHHHYNSGNLHNDISLIR-TPHVD 133
            :|||||||.:......:..|. ::..:.:. :.:||...|..|..:|:..|.|||:||: ..||:
Human    68 FVLTAAHCISNTRTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVE 132

  Fly   134 FWSLVNKVELPSYNDRY-QDYAGWWAVASGWGGTYDGSPLP 173
            ....:....||..:... :||.   ...:|||..:.|...|
Human   133 LSDTIQVACLPEKDSLLPKDYP---CYVTGWGRLWRGLRWP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 40/144 (28%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 39/136 (29%)
Tryp_SPc 30..>173 CDD:238113 40/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.