DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Ctrl

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:278 Identity:92/278 - (33%)
Similarity:140/278 - (50%) Gaps:33/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAAT---AVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCG 64
            |.:.|:|.:..::   .|||      .||......||.||..|..|..|:.|.|. ...|..:||
Mouse     4 LSLTLSLVLLGSSWGCGVPA------ITPALSYNQRIVNGENAVPGSWPWQVSLQ-DNTGFHFCG 61

  Fly    65 GSIIGNTWVLTAAHC--TNGASGVTI-NYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISL 126
            ||:|...||:|||||  |.|...|.: .|..|...:|  ...:.....|.|.::|:..::||::|
Mouse    62 GSLISPNWVVTAAHCQVTPGRHFVVLGEYDRSSNAEP--VQVLSIARAITHPNWNANTMNNDLTL 124

  Fly   127 IR--TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWG---GTYDGSPLPDWLQSVDVQIISQ 186
            ::  :| ..:.:.|:.|.|.|.|:...  :|...|.:|||   |.  |:..|..||.|.:.:::.
Mouse   125 LKLASP-ARYTAQVSPVCLASTNEALP--SGLTCVTTGWGRISGV--GNVTPARLQQVVLPLVTV 184

  Fly   187 SDCSRTWS--LHDNMICINTDGGKSTCGGDSGGPLVTHDGNR--LVGVTSFGSAAGCQSGAPAVF 247
            :.|.:.|.  :.|.|||.. ..|.|:|.||||||||...||.  |:|:.|:|: ..|...|||::
Mouse   185 NQCRQYWGARITDAMICAG-GSGASSCQGDSGGPLVCQKGNTWVLIGIVSWGT-KNCNIQAPAMY 247

  Fly   248 SRVTGYLDWIRDNTGISY 265
            :||:.:..||  |..::|
Mouse   248 TRVSKFSTWI--NQVMAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 81/235 (34%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 80/233 (34%)
Tryp_SPc 34..260 CDD:238113 82/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.