DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG42694

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:225 Identity:51/225 - (22%)
Similarity:87/225 - (38%) Gaps:59/225 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSG-NLHNDISL 126
            |.||:|...:||:||.|.:....:.:..|.|..|:.  .||....:::...|  || .|..||.|
  Fly    58 CSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATKS--PHWYTVSNVVIPSH--SGKRLQRDIGL 118

  Fly   127 IR-TPHVDFWSLV---------NKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWL----- 176
            :: :..||:...|         |.:::......:...|                    ||     
  Fly   119 LKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSA--------------------WLSKNKN 163

  Fly   177 -QSVDVQIISQSDCSRTWSLHDNM----ICINTDGGKSTCGGDSGG----PLVTHDGNRLVGVTS 232
             |::.:..:|:..|.  .:|..|:    ||..:....::|..|||.    |::  .|:.:|....
  Fly   164 PQTIVLSQLSRDRCK--LNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPII--QGSNIVREML 224

  Fly   233 FGSAAGCQSG-----APAVFSRVTGYLDWI 257
            || ..|..:|     .||::..|...:.||
  Fly   225 FG-IRGYVNGRSWCSEPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 51/225 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 51/225 (23%)
Tryp_SPc 46..253 CDD:214473 49/223 (22%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.