DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Tpsab1

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:281 Identity:92/281 - (32%)
Similarity:124/281 - (44%) Gaps:46/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW---CG 64
            |.:.|.|..:...|.|.||.         .:..|..|..|:..|.|:.|.|  ..|..:|   ||
Mouse     5 LLLTLPLLSSLVHAAPGPAM---------TREGIVGGQEAHGNKWPWQVSL--RANDTYWMHFCG 58

  Fly    65 GSIIGNTWVLTAAHCTNGASGVTINYGASIRTQ--PQY----THWVGSGDIIQHHHYNSGNLHND 123
            ||:|...||||||||.    |..:.....:|.|  .||    .|.:....||.|..:.......|
Mouse    59 GSLIHPQWVLTAAHCV----GPDVADPNKVRVQLRKQYLYYHDHLMTVSQIITHPDFYIVQDGAD 119

  Fly   124 ISLIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDG--SPLPDWLQSVDVQIIS 185
            |:|:: |..|:....|:.|.||..::.:......|  .:|||...:|  .|.|..|:.|.|.||.
Mouse   120 IALLKLTNPVNISDYVHPVPLPPASETFPSGTLCW--VTGWGNIDNGVNLPPPFPLKEVQVPIIE 182

  Fly   186 QSDCSRTW--------SLH---DNMICINTDGGKSTCGGDSGGPLV--THDGNRLVGVTSFGSAA 237
            ...|...:        ::|   |:|:|...:|..| |.||||||||  ..|.....||.|:|.  
Mouse   183 NHLCDLKYHKGLITGDNVHIVRDDMLCAGNEGHDS-CQGDSGGPLVCKVEDTWLQAGVVSWGE-- 244

  Fly   238 GC-QSGAPAVFSRVTGYLDWI 257
            || |...|.:::|||.|||||
Mouse   245 GCAQPNRPGIYTRVTYYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 85/248 (34%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 85/248 (34%)
Tryp_SPc 29..265 CDD:214473 83/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.