DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and Ctrc

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:284 Identity:90/284 - (31%)
Similarity:128/284 - (45%) Gaps:54/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVAAATAVPAPAQKL-TPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSIIGN 70
            |.:....|:.|.|... .||...::..|:..|..|.....|:.|.|.:..:..|  .||||:|..
Mouse     2 LGITVLAAILACASSCGDPTFPPNLSARVVGGEDAVPNSWPWQVSLQYLRDDTWRHTCGGSLITT 66

  Fly    71 TWVLTAAHCTNGASGVTINYGASIRTQPQYTHWV----GS-----GDIIQHHHYNSGNLHNDISL 126
            :.|||||||.|  :.:|...|..     :|...|    ||     ..|..|..:|...|.|||::
Mouse    67 SHVLTAAHCIN--TNLTYRVGLG-----KYNLTVEDEEGSVYAEVDTIYVHEKWNRLLLWNDIAI 124

  Fly   127 IRTPHVDFWSLVNKVELPSYNDRYQ-------------DYAGWWAVASGWGGTYDGSPLPDWLQS 178
            |:        |...|||   :|..|             ||.   ...:|||..:...|:.:.||.
Mouse   125 IK--------LAEPVEL---SDTIQVACIPEQDSLLPGDYP---CYVTGWGRLWTNGPIAEVLQQ 175

  Fly   179 VDVQIISQSDCSRT--W--SLHDNMICINTDGGKSTCGGDSGGPL--VTHDGN-RLVGVTSFGSA 236
            ....|::.:.|||.  |  .:.:.|:|...||..|.|.|||||||  ...||. ::.|:.||||:
Mouse   176 GLQPIVNHTTCSRLDWWFIKVRETMVCAGGDGVISACNGDSGGPLNCPVEDGLWQVHGIVSFGSS 240

  Fly   237 AGCQS-GAPAVFSRVTGYLDWIRD 259
            .||.: ..|.||:||:.|:|||::
Mouse   241 RGCNTYKKPVVFTRVSAYIDWIKE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 83/256 (32%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 82/253 (32%)
Tryp_SPc 30..265 CDD:238113 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.