DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and zgc:123295

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:278 Identity:95/278 - (34%)
Similarity:143/278 - (51%) Gaps:21/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 65
            ||:...|.:..|....:.....:|.......:..:|..|..|..|..|:.|.|.....|..:|||
Zfish     1 MKINTALTVVGALLVNIAGSLCQLNVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGG 65

  Fly    66 SIIGNTWVLTAAHCTNGASGVTINYGASIRTQP-----QYTHWVGSGDIIQHHHYNSGNLHNDIS 125
            |:|...|||:||||...:.| ||.....:::|.     |.|..|  ..:|.|.:||:.:..|||:
Zfish    66 SLINKDWVLSAAHCFQDSIG-TIMVKLGLQSQSGSNPYQITKTV--VQVINHPNYNNPSNDNDIA 127

  Fly   126 LIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGG-TYDGSPLPDWLQSVDVQIISQSD 188
            |:: ...|.|...:..|.|.:..:.|.  ||..:..:|||. :...:.:||.||.|::.|:|.||
Zfish   128 LVKLDSSVTFNDYIEPVCLAAAGNTYA--AGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSD 190

  Fly   189 CSRTW--SLHDNMIC--INTDGGKSTCGGDSGGPLVTHDGNRLV--GVTSFGSAAGC-QSGAPAV 246
            |.|.:  .:..||||  :...|||.:|.||||||:|:.:|::.:  |:.|||  .|| :.|.|.|
Zfish   191 CKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFG--RGCAEPGYPGV 253

  Fly   247 FSRVTGYLDWIRDNTGIS 264
            ::||:.|.|||..:||.|
Zfish   254 YARVSQYQDWITSSTGSS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 87/237 (37%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 85/235 (36%)
Tryp_SPc 36..264 CDD:238113 85/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.