DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG17242

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:220 Identity:54/220 - (24%)
Similarity:89/220 - (40%) Gaps:43/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NGNWWCGGSIIGNTWVLTAAHCTNGA--SGVTINYGASIRTQPQYTHWVGSGDIIQHHHYN---S 117
            |....|||.|.....:||.|.|...|  ..:::..|::...        ..|.:::.....   .
  Fly    36 NDKHHCGGVIYSEDIILTIAECVRKARLEFISVRVGSAQEN--------AGGTVLKVEKMRLQVL 92

  Fly   118 GNLHNDISL--IRTP-HVDFWSLVNKVEL------PSYNDRYQDYAGWWAVASGWGGTYDGSPLP 173
            |...:|:::  :|:| ::|  ..:..:.|      |..|          |..||||.....:|..
  Fly    93 GLRPSDVAILQLRSPLYLD--GGIRAIPLATIPLVPGTN----------ASVSGWGQLSAMNPSS 145

  Fly   174 DWLQSVDVQIISQSDCSRTWSLHDNM-----ICINTDGG-KSTCGGDSGGPLVTHDGNRLVGVTS 232
            :.|..|||:|..|..|:...:|...:     ||....|. ...|.|..|||||.:  |||.|:.|
  Fly   146 EVLLRVDVKIQDQLMCATNLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVAN--NRLYGILS 208

  Fly   233 FGSAAGCQSGAPAVFSRVTGYLDWI 257
            :.||....:.: :|::.:..:..||
  Fly   209 WQSACDVLNKS-SVYANIAMFKVWI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 54/220 (25%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 54/220 (25%)
Tryp_SPc 24..232 CDD:214473 52/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.