DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG18754

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:271 Identity:66/271 - (24%)
Similarity:107/271 - (39%) Gaps:62/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PIKDIQGRITNGYPAYE---------GKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGA 83
            |.|...|:.|   |.:.         .:.|::|.||:...      .|:|  .:|||||||..|.
  Fly    92 PNKQTCGQTT---PVFRDRGAENAELNEYPWMVLLLYENR------LSLI--RYVLTAAHCVIGG 145

  Fly    84 SGV-------TINYGAS----IRTQPQYTHW---VGSGDIIQHHHYNSGNLHNDISLIR------ 128
            ...       ::..|.|    |.::.:..|.   ||...:.|....:.|...|||:|:|      
  Fly   146 YLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVR 210

  Fly   129 -TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC-SR 191
             |..:....|:: .|.|..:...|        .|||..|.....|   :.|. |:..:.:|| :|
  Fly   211 YTKKIQPICLLD-AEFPLQDLNLQ--------ISGWDPTKSSQTL---ITST-VKERNPADCLNR 262

  Fly   192 TWSLHD-NMICINTDGGKSTCGGDSGGPLVTHDGNR------LVGVTSFGSAAGCQSGAPAVFSR 249
            ..|... :.:|........||.|.||.|::...|:.      |.|:.|:|......:|.|.|:::
  Fly   263 YPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTK 327

  Fly   250 VTGYLDWIRDN 260
            :..:.:||:.|
  Fly   328 IGHFSEWIKAN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 62/261 (24%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 60/250 (24%)
Tryp_SPc 108..335 CDD:214473 58/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.