DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:265 Identity:265/265 - (100%)
Similarity:265/265 - (100%) Gaps:0/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 65

  Fly    66 SIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTP 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 SIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTP 130

  Fly   131 HVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWSL 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 HVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWSL 195

  Fly   196 HDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDN 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 HDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDN 260

  Fly   261 TGISY 265
            |||||
  Fly   261 TGISY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 223/223 (100%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 223/223 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470715
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.