DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG10232

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:271 Identity:66/271 - (24%)
Similarity:106/271 - (39%) Gaps:65/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITNGYPAYEGKVPYIVGLLFSG------NGNWWCGGSIIGNTWVLTAAHC-------------- 79
            |:..|..|...:.|::..|::..      ..|  |.||:|...:|||||||              
  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNN--CSGSLINKRYVLTAAHCVVKDKMVNTDLVLR 318

  Fly    80 ----------TNGASGVTINYGAS-IRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR--TP- 130
                      ||.....|.|..|. :....:|.:       :...::|:....:||:|:|  || 
  Fly   319 RVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFN-------VHEQYFNTSRFESDIALVRLQTPV 376

  Fly   131 ---HVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRT 192
               |......|.|..:|.:|...|        .:|||.|.:.......|.:...:  ::..|...
  Fly   377 RYTHEILPICVPKDPIPLHNHPLQ--------IAGWGYTKNREYSQVLLHNTVYE--NRYYCQDK 431

  Fly   193 WSL--HDNMICINTDGGKSTCGGDSGGPLVTHDGN------RLVGVTSFGSAAGCQSGAPAVFSR 249
            .|.  :::.||.:...|:.:|.|||||||:....|      .|.|:.|:|| ..|....|.|:::
  Fly   432 ISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGS-ENCGDRKPGVYTK 495

  Fly   250 VTGYLDWIRDN 260
            ...:..||:.|
  Fly   496 TGAFFSWIKAN 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 64/268 (24%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 64/265 (24%)
Tryp_SPc 260..503 CDD:214473 62/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.