DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG8870

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:276 Identity:71/276 - (25%)
Similarity:112/276 - (40%) Gaps:84/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EGKVPYI-----VGLLFSGNGNWW-------CGGSIIGNTWVLTAAHCTN--------------- 81
            :||:|.:     :.:|..||.|..       ||||:|.|.:|||||||..               
  Fly    86 KGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRL 150

  Fly    82 GASGVTINYGASI---RTQ--PQYTHWVGSGDIIQHHHYNSG-NLHNDISLIRTPH-VDFWSLVN 139
            |....:.|...:|   |.|  |.|.. :....||.|..:|.| .|.|||:|:|... |.:...:.
  Fly   151 GEHNTSTNPDRAIVNGRRQYAPLYME-IEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQ 214

  Fly   140 KVELP------SYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQS--------DCS 190
            .:.||      ::..::|        ||||         ||..|.:..:::.:|        .|.
  Fly   215 PICLPRAQKLAAHKRKFQ--------ASGW---------PDMGQGIASEVLLRSFIAERHPDVCK 262

  Fly   191 RTWSLH-DNMICINTDGGKSTCGGDSGGPL----------VTHDGNRLVGVTSFGSAAGC--QSG 242
            ..:..: .:.||.....|..|..|||||||          :|:    ..|:.|:|... |  ::.
  Fly   263 SNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTY----AAGIISYGQKP-CVLKTC 322

  Fly   243 APAVFSRVTGYLDWIR 258
            .||.:::.:.:.:||:
  Fly   323 KPAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 71/276 (26%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 68/269 (25%)
Tryp_SPc 93..337 CDD:214473 66/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.