DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG11037

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:260 Identity:76/260 - (29%)
Similarity:114/260 - (43%) Gaps:45/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKV-PYIVGLLFSGNGNWWCGGSIIGN 70
            |.:|..|...:|:|.:.           |:..|:.....|: .|:..||:  ..::.|||:::..
  Fly    44 LDVAQLAKIVLPSPHET-----------RVIGGHVTTNAKLGGYLTALLY--EDDFVCGGTLLNE 95

  Fly    71 TWVLTAAHCTNG---ASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDIS--LIRTP 130
            ..|||||||..|   ||...:..|.|...|......|  .|.|....:...:::.|::  |::||
  Fly    96 NIVLTAAHCFLGRMKASEWIVAAGISNLNQKGIRRHV--KDFILSEQFREDDMNMDVAVVLLKTP 158

  Fly   131 ----HVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLP-DWLQSVDVQIISQSDC- 189
                ::...||.:....|          |...|.||||.|......| :.|::|.|.||.:.:| 
  Fly   159 LKAKNIGTLSLCSVSLKP----------GVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCR 213

  Fly   190 ---SRTWSLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGA-PAVFSRV 250
               ..|..:.|:|||....|.|..|..|||||||..  .::.|:.|||  .||.|.. |.|::.|
  Fly   214 AAYQPTAKITDSMICAAVLGRKDACTFDSGGPLVFK--KQVCGIVSFG--IGCASNRYPGVYTDV 274

  Fly   251  250
              Fly   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 70/231 (30%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 71/232 (31%)
Tryp_SPc 62..283 CDD:238113 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.