DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and ela2

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001132936.1 Gene:ela2 / 403061 ZFINID:ZDB-GENE-041117-1 Length:266 Species:Danio rerio


Alignment Length:279 Identity:93/279 - (33%)
Similarity:134/279 - (48%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW--C 63
            ||| |.|||.:|.|.....|.       .|.|..|:..|........|:...|.:....:::  |
Zfish     1 MKL-VILALFIAGAYGCGQPT-------YKPIDSRVVGGSDVRPNSWPWQASLQYQSGSSFYHTC 57

  Fly    64 GGSIIGNTWVLTAAHCTNGASGVTI----NYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDI 124
            ||::|...||||||||.:..:...:    |...|..:..|.   :....||.|.:::|.|:.|||
Zfish    58 GGTLIDKQWVLTAAHCISSRTYRVLLGKHNLPLSSESGSQA---ISPARIIVHENWDSYNIRNDI 119

  Fly   125 SLIR--TPHVDFWSLVNKVELPS------YNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDV 181
            :||:  || |.|...::...||.      :|..        ...:|||..:.|.|:.|.||...:
Zfish   120 ALIKLSTP-VTFTDKISPACLPDSGSILPHNSP--------CYVTGWGRLWTGGPIADILQQALL 175

  Fly   182 QIISQSDCSRT--WS--LHDNMICINTDGGKSTCGGDSGGPL--VTHDGNRLV-GVTSFGSAAGC 239
            .|:.|:.|:::  |.  :.|.|:|...||..|:|.|||||||  ...||...| |:.||||:.||
Zfish   176 PIVDQATCTKSDWWGNLVTDLMVCAGGDGVVSSCNGDSGGPLNCQRRDGTWDVHGIVSFGSSLGC 240

  Fly   240 Q-SGAPAVFSRVTGYLDWI 257
            . ...|:||:||:||:.||
Zfish   241 NYPKKPSVFTRVSGYIPWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 80/244 (33%)
ela2NP_001132936.1 Tryp_SPc 27..259 CDD:214473 79/243 (33%)
Tryp_SPc 28..262 CDD:238113 80/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.