DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and Jon74E

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:243 Identity:92/243 - (37%)
Similarity:131/243 - (53%) Gaps:9/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSIIGNTWVLTAAHCTNGASGVTINYGASI 94
            |.|||..|..|...:.||.|||......:.  |||.|:|.:.::||||||...|..:|...|..:
  Fly    28 IGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVL 92

  Fly    95 RTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPH-VDFWSLVNKVELPSYNDRYQDYAGWWA 158
            |..|:......:.::..|..:|..:|.|||:|:|.|. ......:..:.||..:.....|....|
  Fly    93 RLAPRQLIRSTNPEVHLHPDWNCQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA 157

  Fly   159 VASGWGGTYDGS-PLPDWLQSVDVQIISQSDCSRTW-SLHDNMICINTDGGKSTCGGDSGGPLVT 221
            :|||||...|.| .:.|.|:.|...:.|..||..:: ::....||::|.||||||.||||||||.
  Fly   158 IASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVY 222

  Fly   222 HD----GNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNTGISY 265
            .|    .:.|:||||:|..:||..|.|:||:|:|.|||||.:.:|:.|
  Fly   223 SDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 87/232 (38%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 86/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
98.980

Return to query results.
Submit another query.