DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG11529

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:255 Identity:85/255 - (33%)
Similarity:127/255 - (49%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PTPIKDIQGRITNGYPAYEG------KVPYIVGLLFSGNGNW----WCGGSIIGNTWVLTAAHCT 80
            |||        |:.|...:.      |.||.|.|:  |...|    .|||:::...|:|||.|||
  Fly    22 PTP--------TDSYAVGQSKYGRIEKFPYQVMLI--GKQLWRKRILCGGTLLDKRWILTAGHCT 76

  Fly    81 NGASGVTINYGASIRTQPQYTHWVGSGDIIQ------HHHYNSGNLHNDISLIRTPH-VDFWSLV 138
            .|.:    :|...:.|:......|..|.:::      |..:|.....|||:|::.|. |.|...:
  Fly    77 MGVT----HYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRI 137

  Fly   139 NKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWS-LHDNMICI 202
            ....||| ..|:..:||...||||||...:.:. .|.:|..::::||.::|::.:. :...:||.
  Fly   138 QPASLPS-RYRHDQFAGMSVVASGWGAMVEMTN-SDSMQYTELKVISNAECAQEYDVVTSGVICA 200

  Fly   203 NTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNTG 262
            .....::.|.||||||||..|...:||:||||.|.||::..|..|:|||.|||||....|
  Fly   201 KGLKDETVCTGDSGGPLVLKDTQIVVGITSFGPADGCETNIPGGFTRVTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 81/241 (34%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 79/228 (35%)
Tryp_SPc 37..255 CDD:214473 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
87.870

Return to query results.
Submit another query.