DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG32374

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:269 Identity:87/269 - (32%)
Similarity:129/269 - (47%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLALAVAAATAVPA-PAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIG 69
            ||...::...|:.| .||...||       ||.||......:.||...|.:  |..:.||..|:.
  Fly    50 FLPGNISTNPAINALEAQDYLPT-------RIVNGKKIKCSRAPYQCALHY--NNYFICGCVILN 105

  Fly    70 NTWVLTAAHCTNGASG-VTINYGAS-IRTQPQYTHWVGSGDIIQ----HHHYNSGNLHNDISL-- 126
            ..|:|||.||..|..| .|:..|:: .|...|..|       :|    |.:|:...:.||:.:  
  Fly   106 RRWILTAQHCKIGNPGRYTVRAGSTQQRRGGQLRH-------VQKTVCHPNYSEYTMKNDLCMMK 163

  Fly   127 IRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGT-YDGSPLPDWLQSVDVQIISQSDCS 190
            ::|| ::....|.||:|||  .|.:.:...: :|||||.| .:...:..:|:.|.|..:|::.|.
  Fly   164 LKTP-LNVGRCVQKVKLPS--TRTKRFPKCY-LASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQ 224

  Fly   191 RTW-----SLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGA-PAVFSR 249
            :.:     .::..|||.... .:.||.|||||||| |:| .|.|:||||  .||.|.. |.|:..
  Fly   225 QDYRGTGIKIYKQMICAKRK-NRDTCSGDSGGPLV-HNG-VLYGITSFG--IGCASAKYPGVYVN 284

  Fly   250 VTGYLDWIR 258
            |..|..||:
  Fly   285 VLQYTRWIK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 78/238 (33%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 77/236 (33%)
Tryp_SPc 74..295 CDD:238113 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.