DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and sphinx2

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:293 Identity:77/293 - (26%)
Similarity:135/293 - (46%) Gaps:68/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGN------- 58
            |||.|  ||.|.:.|.......||:|        |||.||.|....:.|:||::::.:       
  Fly     1 MKLVV--ALLVLSLTFSVCEKNKLSP--------RITGGYRAKPYTIIYLVGIVYAKSPLSSLKF 55

  Fly    59 GNWWCGGSIIGNTWVLTA----------AHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQ-- 111
            |    .|:||.|.|:||.          ||           :|:      :...|  ..||::  
  Fly    56 G----AGTIISNQWILTVKEVLIFKYIEAH-----------FGS------KRAFW--GYDILRIY 97

  Fly   112 ----HHHYNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPL 172
                :.||:...:   |:|::.|:..|...:::|.:|:|..|::.|.|...:..|||.......|
  Fly    98 RENFYFHYDKTRI---IALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRL 159

  Fly   173 PDWLQSVDVQIISQSDCSRTWSLHDNM----ICINTDGGKSTCGGDSGGPLVTHDGN-RLVGVTS 232
            |.|::.|:|::::.::|::   .|..:    :|.:.:|.|..|.||.||.:||...| ..:|:. 
  Fly   160 PTWMRCVEVEVMNNTECAK---YHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFIGII- 220

  Fly   233 FGSAAGCQSGAPAVFSRVTGYLDWIRDNTGISY 265
            :.....|..|.|:|..||:.::.||:..:|:.:
  Fly   221 WLMPTNCSIGYPSVHIRVSDHIKWIKHVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 64/251 (25%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 63/249 (25%)
Tryp_SPc 26..248 CDD:304450 64/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.