DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and Jon65Aii

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:274 Identity:161/274 - (58%)
Similarity:188/274 - (68%) Gaps:31/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAATAVPAPAQKLTPTPIKD------IQGRITNGYPAYEGKVPYIVGLLF-SGN-G 59
            :.:|.|.|:.||..        .|.|:||      |.||||||||||||||||||.|.| :|| |
  Fly     6 VLLFSAFALVAALE--------RPVPVKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNGG 62

  Fly    60 NWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDI 124
            .|:|||||||:.|||||||||.|||.|||:|||..|.|||:|            ||::|||||||
  Fly    63 GWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFT------------HYDTGNLHNDI 115

  Fly   125 SLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC 189
            :|||||||||||||||||||.|:|||.::.||||:.||||.:.|.|.:.|:|..||:||...|.|
  Fly   116 ALIRTPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSGMTDYLNCVDIQISDNSVC 180

  Fly   190 SRTWSLH---DNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVT 251
            ...:..|   .|.:|..|...|.:|.||||||||.|||||.||:.||||||||.|.:|...:|||
  Fly   181 LDYYGSHYITSNHLCYATPENKGSCSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVT 245

  Fly   252 GYLDWIRDNTGISY 265
            ||||||||:|||||
  Fly   246 GYLDWIRDHTGISY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 143/228 (63%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 141/226 (62%)
Tryp_SPc 37..254 CDD:238113 143/228 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470774
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.