DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG32833

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:282 Identity:59/282 - (20%)
Similarity:108/282 - (38%) Gaps:47/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIG 69
            :||||.|.:.:...| .:........|.......|:|......|:|..:.......  |.|:|..
  Fly     8 IFLALFVLSKSDTGA-GEDSEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKAK--CDGAIYK 69

  Fly    70 NTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR-TPHVD 133
            .:.::||..|.:|.....|.......|:......|...:|..|..:....:.::::::: ...::
  Fly    70 LSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVIEVAVCNITVHEKFTGQTVFHNVAILKLCEPLE 134

  Fly   134 FWSLVNKVEL----------------PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQ 182
            ....:..::|                ||:.        |||:.  |....|.....  ||..:|:
  Fly   135 ASKTIQPIQLANQLPSNGAKVTANGWPSFR--------WWAMY--WKKCLDDEAYK--LQKAEVK 187

  Fly   183 IISQSDCSRTWSLH--------DNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGC 239
            ::..|.|:..|:.:        |::.| .....|..|....|.|:| |:| :|||:.:.|   ||
  Fly   188 LLGPSQCTDLWARNNWSKKNFTDDLFC-TEKFAKEACSLAMGSPVV-HNG-KLVGIITKG---GC 246

  Fly   240 QSGAPAVFSRVTGYLDWIRDNT 261
             |..|.|:..:..|.||:.::|
  Fly   247 -SEYPEVYINLIKYKDWLHNHT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 51/248 (21%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 51/246 (21%)
Tryp_SPc 40..262 CDD:214473 49/242 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.