DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and iotaTry

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:248 Identity:73/248 - (29%)
Similarity:106/248 - (42%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DIQ--GRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTI----- 88
            |::  |||..|........|:.|.:..|....  |||.|.....::||.||.:..| ||:     
  Fly    21 DVEATGRIIGGSDQLIRNAPWQVSIQISARHE--CGGVIYSKEIIITAGHCLHERS-VTLMKVRV 82

  Fly    89 -----NYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR--TPHVDFWSLVNKVELPSY 146
                 |||.::.....|.         .|..::|..||.||:::|  || :.|......:.|.|.
  Fly    83 GAQNHNYGGTLVPVAAYK---------VHEQFDSRFLHYDIAVLRLSTP-LTFGLSTRAINLAST 137

  Fly   147 NDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC-SRTWS-----LHDNMIC-INT 204
            :..    .|.....:|||.| |...|.|.||...:|||.:.:| |:.:.     :.:..|| .:|
  Fly   138 SPS----GGTTVTVTGWGHT-DNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAAST 197

  Fly   205 DGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257
            |.  ..|.||||||||.  .::|||:.|:|... .....|.|::.|.....||
  Fly   198 DA--DACTGDSGGPLVA--SSQLVGIVSWGYRC-ADDNYPGVYADVAILRPWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 70/241 (29%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 69/240 (29%)
Tryp_SPc 28..247 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.