DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG12133

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:106/282 - (37%) Gaps:105/282 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIR-------T 96
            ||.||..|          ...:..|.||:|.:.:|||||||.|    |...|.|.:|       .
  Fly    80 GYEAYTAK----------QRPSPMCAGSLIASRYVLTAAHCLN----VNDFYVARVRLGEHDTEN 130

  Fly    97 QPQYTHWVGSG---------DI-----IQHHHY--NSGNLHNDISLIRTPHVDFWSLVNKVELPS 145
            .|.|| |:.:|         ||     :.|..|  .:|..:|||:|:|        |.::|:   
  Fly   131 DPDYT-WLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLR--------LKSRVK--- 183

  Fly   146 YNDRYQDYAGWWAV-------------ASGWG-------------GTYDG-SP------LPDWLQ 177
            |..:.:....|..:             .:|||             ||..| ||      .|..|.
  Fly   184 YTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLV 248

  Fly   178 SVDVQIISQSDCSRTWSLHDNMICINTDGGKSTCGGDSGGPLVTHDGN------RLVGVTSFGSA 236
            ..|:||     |:..|.        .||.|.    ||||.||:...|.      .|.|:||:|..
  Fly   249 DKDIQI-----CAMGWD--------GTDTGL----GDSGSPLMASVGRGADQFYYLAGITSYGGG 296

  Fly   237 AGCQSGAPAVFSRVTGYLDWIR 258
            .......|||:::.:.|.:||:
  Fly   297 PSSYGYGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 76/282 (27%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 76/282 (27%)
Tryp_SPc 62..317 CDD:214473 74/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.