DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG9377

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:258 Identity:57/258 - (22%)
Similarity:99/258 - (38%) Gaps:58/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GYPAYE---GKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTI-----NYGASIR 95
            ||...|   |:.|::|.:.  |:..:.|.|::|....|:|.|||...:....:     .:.|::.
  Fly   101 GYKQQEAKFGEFPWLVAVY--GSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVE 163

  Fly    96 TQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPHVDFWSLVNKVE---LP------SYNDRYQ 151
            .:||........:.:.|.:|....|.::|:::.......:.|...|:   ||      :|:..| 
  Fly   164 LEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCY- 227

  Fly   152 DYAGWWAVASGWGGTYDG--SPLPD-WLQSVDVQIISQSDC---------SRTWSLHDNMICINT 204
                    .|||..:..|  :.||. |    .:.::....|         .|..:.:|:::|...
  Fly   228 --------VSGWQRSDFGRAAILPKRW----TLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGG 280

  Fly   205 DGGKSTCGG-DSGG-----PLVTHDGN-RLVGVTSFGSAAGCQSGAP---AVFSRVTGYLDWI 257
            |.|...||. |...     ||..||.. .|.|:.:  ..|.|.  .|   .:::.|..|..||
  Fly   281 DKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLT--RTARCD--GPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 57/258 (22%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 55/254 (22%)
Tryp_SPc 105..339 CDD:214473 53/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.