DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG31220

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:289 Identity:78/289 - (26%)
Similarity:119/289 - (41%) Gaps:61/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAPAQKLTPTP---IKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--------WCGGSIIGNT 71
            |.||..|...|   ......|:..|......:.|::..||:.....:        .||||:|...
  Fly    83 PKPANTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTR 147

  Fly    72 WVLTAAHC----------------TNGASGVTINYGASIRTQPQYTHW-VGSGDIIQHHHYNSGN 119
            :|||||||                |...:...|:.||.|...|  ||. :....|..|:.|:..|
  Fly   148 YVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAP--THLDIDVESITSHNDYDPAN 210

  Fly   120 --LHNDISLIRTPHVDFWSL----VNKVELPSYNDRYQDYAGWWAVASGWG--GTYD-GSPLPDW 175
              ..|||:|:|......:::    :..::.|....:::.|      .:|||  |.:| ||.:   
  Fly   211 YTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY------VAGWGKTGMFDTGSKV--- 266

  Fly   176 LQSVDVQIISQSDCSRTWSLHDN-----MICINTDGGKSTCGGDSGGPLVTHDGNR------LVG 229
            |:...|::....:||..:: |.:     .||......:.||.||||.||:...|..      |.|
  Fly   267 LKHAAVKVRKPEECSEKYA-HRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAG 330

  Fly   230 VTSFGSAAGCQSGAPAVFSRVTGYLDWIR 258
            :||:|...| ..|.|:||:|...:..|||
  Fly   331 ITSYGGPCG-TIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 72/268 (27%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 70/266 (26%)
Tryp_SPc 104..360 CDD:238113 72/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.