DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG8952

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:272 Identity:93/272 - (34%)
Similarity:143/272 - (52%) Gaps:20/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNT 71
            :.:.:||.:.|..|......:||| |..||.:|..|..|:.|:.|.|......:..||||||.:|
  Fly    10 MLVLLAAISVVGQPFDPANSSPIK-IDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDT 73

  Fly    72 WVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPH-VDFW 135
            |||||||||||.|.:.:.:|..........: :.|.:||.|..||. .|:||:|||:.|. :.|.
  Fly    74 WVLTAAHCTNGLSSIFLMFGTVDLFNANALN-MTSNNIIIHPDYND-KLNNDVSLIQLPEPLTFS 136

  Fly   136 SLVNKVEL-PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSV---DVQIISQSDCSRTWSLH 196
            :.:..::| ..|.|.. ||.|..|..:|:|.|.|  ...|:.:::   .|:||..:||...:..:
  Fly   137 ANIQAIQLVGQYGDSI-DYVGSVATIAGFGYTED--EYLDYSETLLYAQVEIIDNADCVAIYGKY 198

  Fly   197 ---DNMICINTDGGK--STCGGDSGGPLVTHDGN----RLVGVTSFGSAAGCQSGAPAVFSRVTG 252
               |:.:|.....|.  |||.|||||||:.::..    :.:|:.||.:...|....|:.::||:.
  Fly   199 VVVDSTMCAKGFDGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSS 263

  Fly   253 YLDWIRDNTGIS 264
            :|.:|.|.|||:
  Fly   264 FLGFIADKTGIA 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 80/237 (34%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 80/235 (34%)
Tryp_SPc 38..271 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471046
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.