DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG31681

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:276 Identity:86/276 - (31%)
Similarity:126/276 - (45%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALA-VAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGS 66
            |.:.:::| :|.|..:|.|.:::           :...|...| .||:.|.:  ..|....|||.
  Fly     7 LSILVSIAGLACAARIPGPEERI-----------VGGSYIPIE-YVPWQVSV--QNNSLHCCGGV 57

  Fly    67 IIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDI------IQHHHYNSGNLHN--D 123
            |..:..:||||||   .|.||:. ..|:|....|  |...|.:      |.|..| ...|:|  |
  Fly    58 IYSDRAILTAAHC---LSNVTVT-DLSVRAGSSY--WSKGGQVLKVLKTIAHPKY-VPKLYNPYD 115

  Fly   124 IS-LIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDW--LQSVDVQIIS 185
            |: ||....:.....|.|:.|....    ..||...:.||||.|.:.|... |  ||.|.|.|::
  Fly   116 IAVLILEAPLRLGGTVKKIPLAEQT----PVAGTIVLTSGWGYTRENSSFL-WPILQGVHVAILN 175

  Fly   186 QSDCSRTWSLHDN----MICINTDGGK-STCGGDSGGPLV--THDGNR-LVGVTSFGSAAGCQSG 242
            ::||.:.:. |.|    |||  .||.: .||.|||||||:  |..|:| |:|:.|:|...|..  
  Fly   176 RTDCLKAYK-HVNITIDMIC--ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN-- 235

  Fly   243 APAVFSRVTGYLDWIR 258
             |.|:..:..:.:||:
  Fly   236 -PGVYEDIAFFHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 80/242 (33%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/252 (31%)
Tryp_SPc 29..250 CDD:238113 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.