DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG31267

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:274 Identity:85/274 - (31%)
Similarity:120/274 - (43%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSI 67
            :.|.|||:.:.|:...................||..|..:.....||:|.|. :..||.:|.|||
  Fly    12 VLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQ-NAYGNHFCAGSI 75

  Fly    68 IGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSG------DIIQHHHYNSGNLHNDISL 126
            |.:.||:|||.|   .:|:..|....:.|  .|.||...|      ||:.|.:::|...||||:|
  Fly    76 IHDQWVITAASC---LAGLRKNNVQVVTT--TYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIAL 135

  Fly   127 IRTPHVDFWSLVNKVELPSYNDRYQDYA---------GWWAVASGWGGTYDGSPLPDWLQSVDVQ 182
            |:| |..|          .|:|..|:..         |......|:|.|..|......||.:||.
  Fly   136 IKT-HALF----------DYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVT 189

  Fly   183 IISQSDCSRTW----SLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGA 243
            .::...|:.|:    .|....:|.....|...|.||:|||:|...| |||||.::|  ..|..|.
  Fly   190 YVAPEKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRG-RLVGVGNWG--VPCGYGF 251

  Fly   244 PAVFSRVTGYLDWI 257
            |.||:|::.|..||
  Fly   252 PDVFARISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 79/241 (33%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 78/240 (33%)
Tryp_SPc 45..268 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.