DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG32808

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:234 Identity:80/234 - (34%)
Similarity:117/234 - (50%) Gaps:16/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGAS--GVTINYGASI-- 94
            |:|.||..|..|:.|::|.|..:.:|...||.:::...||||||||..|:|  .:.:.||:.:  
  Fly    28 GKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQYGSQMLA 92

  Fly    95 RTQPQYTHWVGSGDIIQHHHYNSGNLH-NDISLIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWW 157
            |...|......   |..|..|...:.: |||:|:: ...|.....|..|.||.........|.  
  Fly    93 RNSSQVARVAA---IFVHPGYEPEDKYVNDIALLQLAQSVALSKFVQPVRLPEPRQVTPGNAS-- 152

  Fly   158 AVASGWGGTYDGSPLPDWLQSVDVQIISQSDCS---RTWSLHDNMICIN-TDGGKSTCGGDSGGP 218
            ||.:|||....|..:...||.|.:|:.|.::||   :|: |||:.||.. .:|||..|.||||||
  Fly   153 AVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTY-LHDSQICAGLPEGGKGQCSGDSGGP 216

  Fly   219 LVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257
            |:....:..||:.|:......:...|.||:.|:.|:|||
  Fly   217 LLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 79/232 (34%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/231 (33%)
Tryp_SPc 30..258 CDD:238113 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.