DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG32523

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:251 Identity:75/251 - (29%)
Similarity:116/251 - (46%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRT 96
            |:.||..|..|.:|:.|:.:.|..  .|..:|||.||..|.|:||.||        :.:|..:..
  Fly    33 IEPRIVGGIKAKQGQFPHQISLRL--RGEHYCGGVIISATHVITAGHC--------VKHGNDVVP 87

  Fly    97 QPQYTHWVGS------------GDIIQHHHYNSGNLHNDISLIR--TPHVDFWSLVNKVELPSYN 147
            ...::...||            .::|.|.:|.:|. |||::::|  :| :.|.:.:..::|.:  
  Fly    88 ADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSP-LTFDANIAAIQLAT-- 148

  Fly   148 DRYQDYAGWWAV-ASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTW----SLHDNMICINTDGG 207
               :|.....|| .||||...:..||.|.|..|.|..||:..|  .|    .|.:.|||:.....
  Fly   149 ---EDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGAC--RWMFYSRLPETMICLLHSKN 208

  Fly   208 KSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNTGI 263
            ...|.|||||| .|: |.::||:.|.....||...||..:.|::....||.:..|:
  Fly   209 SGACYGDSGGP-ATY-GGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKAGL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 72/242 (30%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/240 (30%)
Tryp_SPc 37..219 CDD:238113 58/200 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.