DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG18420

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:265 Identity:67/265 - (25%)
Similarity:104/265 - (39%) Gaps:63/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTIN 89
            |.:|:| :..||.||..|.....|::..|..|.| .:.|||::|....|||||||....:.:.:.
  Fly    33 TRSPLK-LGPRIVNGKVAVRNSSPWMAFLHTSSN-QFICGGTLISRRLVLTAAHCFIPNTTIVVR 95

  Fly    90 YGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYA 154
            .|...|....|..........||..|:.....|||:|:|        ||:.|   .|....:...
  Fly    96 LGEYNRKLKGYREEHQVNRTFQHRFYDPNTHANDIALLR--------LVSNV---VYKANIRPIC 149

  Fly   155 GWW-------------AVASGWGGT---YDGSPLPDWLQSVDV-----------QIISQSDCSRT 192
            ..|             ...:|||.|   :|.|.    |:::|:           .::|...|:..
  Fly   150 IMWDASWKHHIDSIKVLTGTGWGRTESMHDSSE----LRTLDISRQPSKMCAFGSVLSNQFCAGN 210

  Fly   193 WSLHDNMICINTDGGKSTCGGDSGGPLVT----HDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGY 253
            |:             .:.|.||:|||:..    .:..|.|.|....:...||  .|:||:.|..:
  Fly   211 WN-------------SNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQ--RPSVFTDVMSH 260

  Fly   254 LDWIR 258
            :::||
  Fly   261 IEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 63/254 (25%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 62/252 (25%)
Tryp_SPc 43..267 CDD:238113 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.