DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG33461

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:262 Identity:63/262 - (24%)
Similarity:102/262 - (38%) Gaps:61/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWW-CGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQP 98
            :|.||.||..|:.|:   :.|.....:: |.||:|...:|||:|||......:....|.:.|...
  Fly    41 KIINGTPARLGRYPW---MAFLHTPTYFLCAGSLINQWFVLTSAHCIEDDVELIARLGENNRDND 102

  Fly    99 ---------QYTHWVGSGDIIQHHHYNSGNLHNDISLIR-------TPHVDFWSLVNKVELPSYN 147
                     :.|.......:.:|..|:..:..|||.::|       |.|:....:.:...:....
  Fly   103 IDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVV 167

  Fly   148 DRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIIS-------------QSDCSRTWSLH--D 197
            |:..     |..|:|||           |.|.|:...|             ::||:|.:..:  .
  Fly   168 DQIT-----WFKATGWG-----------LTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLS 216

  Fly   198 NMICINTDGGKSTCGGDSGGP----LVTHDGNRLV--GVTSFGSAAGCQSGAPAVFSRVTGYLDW 256
            ..||...|.| :.|.||||||    ::.....|.|  |:.|| :...|..  .::.:.|..|..|
  Fly   217 GQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKRFVQMGIASF-TYENCSK--VSILTDVVRYGRW 277

  Fly   257 IR 258
            |:
  Fly   278 IK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 63/261 (24%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 61/259 (24%)
Tryp_SPc 42..281 CDD:238113 63/261 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.