DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG30091

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:253 Identity:76/253 - (30%)
Similarity:112/253 - (44%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQ 99
            :|..|..|.|.|.|::.  |...|..:.||||:|.|.:|||||||........:.|.....|...
  Fly    36 KIVGGVDAGELKNPWMA--LIKTNDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGV 98

  Fly   100 YTHWVGSGDIIQHHH----YN-----------SGNLHNDISLIR-------TPHVDFWSLVNKVE 142
            | |.:.:|   :|:|    ||           ..|..|||:|:|       .|.:....::...:
  Fly    99 Y-HLLATG---EHNHPHEIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQ 159

  Fly   143 LPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRT-WSLHD-NMICINTD 205
            |....|..|::     .|.|||.|.:|. :.:.||.|.:..|.:..|... |...| .|.|..|.
  Fly   160 LKPQTDLIQEF-----TAIGWGVTGNGK-MSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTA 218

  Fly   206 GGKSTCGGDSGGPLVTH---DGNR---LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257
            .|:.||..||||||..|   ||.:   .:|:.|.|: ..|:..  .:::.|.|::|:|
  Fly   219 VGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGT-EDCRGF--GMYTDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 76/252 (30%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 75/251 (30%)
Tryp_SPc 37..276 CDD:238113 76/252 (30%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.