DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG30087

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:253 Identity:80/253 - (31%)
Similarity:118/253 - (46%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGA-SIRTQP 98
            |:.||..|.....|::|  ..:.|....|||||:.:.::||||||.  ...:.:..|. :|||.|
  Fly    41 RVVNGKEAVIRSAPFMV--YVTNNSLTHCGGSILNSRYILTAAHCV--FPNLRLRLGEHNIRTDP 101

  Fly    99 ------------QYTHWVGSGDIIQHHHYNSGNLHNDISLIR-------TPHVD-FWSLVNKVEL 143
                        :|    |....|.|..||:.|..|||:|::       ..|:. ...|:|....
  Fly   102 DCQGSNCSPRSEEY----GIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASA 162

  Fly   144 PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWS--LHDNMICINTDG 206
            ||. ..||.:        |||.|.... .|..||:.:::....:.|||::.  ::.|.||...: 
  Fly   163 PSV-ATYQTF--------GWGETKKNG-FPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGHE- 216

  Fly   207 GKSTCGGDSGGPLVTH---DGNR---LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIR 258
            .:.||.|||||||||.   ||.:   .:|:.|:| ...|||  |.|::.|..|::|||
  Fly   217 ERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYG-PTDCQS--PGVYTYVPNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 79/252 (31%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 77/250 (31%)
Tryp_SPc 42..272 CDD:238113 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.