DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG30083

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:257 Identity:73/257 - (28%)
Similarity:128/257 - (49%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 APAQKLTPT-PIKDIQGRITNGYPAYEGKVPYIVGLLFSGN----GNWWCGGSIIGNTWVLTAAH 78
            |.:|.|.|. ...||..:|.:|..|..|..|: :..:|..|    ....|||::|...:||:|||
  Fly    16 AMSQFLEPNCGYPDISPKIMHGQNAENGTNPW-MAYIFKYNDKEVAELVCGGTLIHKQFVLSAAH 79

  Fly    79 CTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIR-TPHVDFWSLVNKVE 142
            |......:.:..|     :...:.:.......::.::.:|:..|||.::| .|.|.|.:::..:.
  Fly    80 CIKRDQILAVRLG-----EHSSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPIC 139

  Fly   143 L---PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC-SRTW-SLHDNMICI 202
            :   |:.....:.:.     |:|||.| :.......|::|::..::.|:| :..| ::.::.||.
  Fly   140 IITDPTKVPNVKTFK-----AAGWGKT-ENETFSKVLKTVELNELNASECYNMLWVNVTESQICA 198

  Fly   203 NTDGGKSTCGGDSGGPLVTH----DGN-RLV--GVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257
            ....| .||.|||||||: |    ||: |.|  |:.||||:. |.|  |.|::|::.::|||
  Fly   199 GHPDG-DTCAGDSGGPLI-HPVYMDGSLRYVQLGIISFGSSL-CNS--PGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 67/239 (28%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 65/238 (27%)
Tryp_SPc 34..255 CDD:238113 65/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.