DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and CG43335

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:246 Identity:72/246 - (29%)
Similarity:119/246 - (48%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQ 99
            ||..|..|.....|::..|.  ...:::|.|::|.|.:|||||||...:..:|:..|.|..|:..
  Fly    41 RIIGGSDAEITSHPWMAYLY--NEFHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSD 103

  Fly   100 YTHWVGS-----------GDIIQHHHYNSGNLHNDISLIRTPH-VDFWSLVNKVEL---PSYNDR 149
                 ||           ...|:|.::....:.|||::||... |.|:..:..:.:   |:....
  Fly   104 -----GSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLL 163

  Fly   150 YQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTW--SLHDNMICINTDGGKSTCG 212
            .:|  |...:|:|| |..|....|..||...:.:::::.||:.:  ::....||.. |...:||.
  Fly   164 LED--GMTLMATGW-GLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAG-DKETNTCL 224

  Fly   213 GDSGGPL---VTHDGN-RLV--GVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257
            |||||||   |.:.|: |.|  |:||||... |:|  |::::.::.|..||
  Fly   225 GDSGGPLGGVVNYYGDLRFVQYGITSFGDIE-CRS--PSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 71/245 (29%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 70/244 (29%)
Tryp_SPc 42..275 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436063
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.