DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and Prss29

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:289 Identity:92/289 - (31%)
Similarity:127/289 - (43%) Gaps:56/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGL-LFSGNGNWW-- 62
            :.|| ||..::|   ..|||.      |...:.| |..|:.|.:||.|:.|.| ::.....:|  
Mouse     7 LTLF-FLGCSIA---GTPAPG------PEGVLMG-IVGGHSAPQGKWPWQVSLRIYRYYWAFWVH 60

  Fly    63 -CGGSIIGNTWVLTAAHCTNGAS----------GVTINYGASIRTQPQYTHWVGSGDIIQHHHYN 116
             ||||||...||||||||.....          |....||..        ..:....:|.|..:.
Mouse    61 NCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGK--------ELLSVSRVIIHPDFV 117

  Fly   117 SGNLHNDISLIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWG--GTYDGSPLPDWLQS 178
            ...|.:|::|:: ...|..:..|..|:|||.:.........|  .:|||  .|:...|.|..||.
Mouse   118 HAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCW--VTGWGAVSTHRSLPPPYRLQQ 180

  Fly   179 VDVQIISQSDCSRTW---SLHDN---------MICINTDGGKSTCGGDSGGPLVTH-DGN-RLVG 229
            |.|:||..|.|...:   :.|.|         |:|.... |:.:|.||||||||.: .|: .|||
Mouse   181 VQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQ-GQDSCYGDSGGPLVCNVTGSWTLVG 244

  Fly   230 VTSFGSAAGCQ-SGAPAVFSRVTGYLDWI 257
            |.|:|  .||. ...|.|::||..:|.||
Mouse   245 VVSWG--YGCALRDFPGVYARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 82/254 (32%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 82/254 (32%)
Tryp_SPc 31..271 CDD:214473 80/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.