DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ciii and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:315 Identity:93/315 - (29%)
Similarity:134/315 - (42%) Gaps:82/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLALAVAAATAVPAPAQKLTPTPIKDIQGR---------------ITNGYPAYEGKVPYIVGLL 54
            ||.::.|:..|.:|.       |...:::||               |.....|.:.....:.|::
Zfish   243 VFYSIPVSDVTNLPY-------TSNVNVKGRWVFRVDNSSEVKGSCINTNSQALDSPSAAVCGII 300

  Fly    55 --FSGNG----------NW-------W-----CGGSIIGNTWVLTAAHCTNGASG---VTINYGA 92
              .|.||          :|       |     ||||:|...|||:||||.||...   :|:..|.
Zfish   301 PVNSSNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTVILGP 365

  Fly    93 SIRTQPQYTHWVGSGD----------IIQHHHYNSGNLHNDISLIRTPH-VDFWSLVNKVELPSY 146
              :||.:|       |          :|:|.:||.....|||:|:|... :.|...:..|.|.:.
Zfish   366 --KTQNKY-------DPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAE 421

  Fly   147 NDRYQDYAGWWAVASGWGGTYDGSPLPD--WLQSVDVQIISQSDCSRTW---SLHDNMICIN-TD 205
            ...:......|...  |....||.|||.  ..|.|:|.:|....|:..:   |:.|||||.. ..
Zfish   422 GSVFNSDTESWITT--WRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAGLLK 484

  Fly   206 GGKSTCGGDSGGPLVTHDGNRLV--GVTSFGSAAGC-QSGAPAVFSRVTGYLDWI 257
            .||..|.||||||:|::..:..|  |:.||||  || ||..|.|::||:.|.:||
Zfish   485 EGKDLCQGDSGGPMVSNQSSVWVQSGIVSFGS--GCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 85/269 (32%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 8/35 (23%)
Tryp_SPc 309..537 CDD:238113 77/240 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.