DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trp and Xndc1

DIOPT Version :9

Sequence 1:NP_476768.1 Gene:trp / 43542 FlyBaseID:FBgn0003861 Length:1275 Species:Drosophila melanogaster
Sequence 2:NP_001316819.1 Gene:Xndc1 / 102549471 RGDID:7692537 Length:407 Species:Rattus norvegicus


Alignment Length:278 Identity:50/278 - (17%)
Similarity:89/278 - (32%) Gaps:79/278 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   867 SDPIGSKRSSMQRHSQRSLRRKIIEQANEGLQMNQTQLIEFNPNLGDVTRATRVAYVKFMRKKMA 931
            |||:....|                ..:.||..|.:..:|.:|:......:.|..:.        
  Rat   158 SDPVKDPSS----------------PGSSGLNQNSSDKLESDPSPWLTNPSIRRTFF-------- 198

  Fly   932 ADEVSLADDEGAPNGEGEKKPLDA-SGSKKSITSGGTGGGASMLAAAALRASVKNVDEKSGADGK 995
                        |:.:...|.:.| .|..|.:..|..|..|.|:.:||.:|...:|...:.:.|:
  Rat   199 ------------PDPQTSTKEISALKGMLKQLQPGPLGRAARMVLSAAHKAPPASVVSPNNSHGE 251

  Fly   996 PGTMGKPTDDKKAGDDKDKQQPPKDSKPSAGGPKPGDQKPTP---GAGAPKPQAAGTISKPGESQ 1057
            |.:......:.:|      ::|.:.:..|.|..:...::..|   .:..|..:|.|.        
  Rat   252 PDSSHPERAEPRA------EEPNRKNNASRGKRRKVQEQRRPLSSSSSQPNRRATGR-------- 302

  Fly  1058 KKDAPAPPTKPGDTKPAAPKPGE-----------------SAKPEAAAKKEESSKTEASKPAATN 1105
                    ||....:|.|...|.                 .|.|..||...|||..:.:.|.:.:
  Rat   303 --------TKQRQQRPQAKSDGSGVQATGQCPICTGSFSIEALPRHAATCGESSPPQPASPTSLS 359

  Fly  1106 GAAKSAAPSAPSDAKPDS 1123
            .:......|:|..:.|.|
  Rat   360 SSESVLWVSSPESSPPPS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trpNP_476768.1 trp 16..776 CDD:273311
ANK 64..>168 CDD:238125
ANK repeat 69..98 CDD:293786
ANK repeat 99..135 CDD:293786
ANK repeat 137..168 CDD:293786
TRP_2 178..236 CDD:285535
BASP1 938..1158 CDD:283191 40/207 (19%)
Xndc1NP_001316819.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000660
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.