DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15515 and Cpr78E

DIOPT Version :10

Sequence 1:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:101 Identity:32/101 - (31%)
Similarity:46/101 - (45%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFTALVALMAAHSSAGLLDYVF-----PTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMN 66
            :|..||....|...||. :|:|.     |..:.|..::......|.|:....:|:.|.|..|:.|
  Fly     4 ILIVALSLCTAVVLSAP-VDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRN 67

  Fly    67 PGTPDEQLVVMGMYSSYDEKTDTETVTMYTADKDGY 102
            .||.:|.|.:.|.||.:|......||| |.||..|:
  Fly    68 QGTENEYLEISGSYSYFDANGQEVTVT-YKADDHGF 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15515NP_001263088.1 None
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.