DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15515 and Cpr65Ea

DIOPT Version :9

Sequence 1:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:98 Identity:29/98 - (29%)
Similarity:41/98 - (41%) Gaps:16/98 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLLLFTALVALMAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNPGT 69
            ||||   :|||.....:|.|.|   .||.....|| .|...|.:..|:.:|.:.:|.|:..:.  
  Fly     3 KLLL---VVALFGCALAAPLND---DTITKFLANQ-DTDGTYAYDIEQASGIQIKEEGLAGHE-- 58

  Fly    70 PDEQLVVMGMYSSYDEKTDTETVTMYTADKDGY 102
                  ..|.| ||..........:||||:.|:
  Fly    59 ------AHGSY-SYISPEGIPVQVVYTADEFGF 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15515NP_001263088.1 Chitin_bind_4 46..102 CDD:278791 13/55 (24%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.