DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15515 and Lcp65Ag2

DIOPT Version :10

Sequence 1:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster


Alignment Length:98 Identity:29/98 - (29%)
Similarity:48/98 - (48%) Gaps:8/98 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLFTALVALMAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNPGTP 70
            |::|.||.|:..|..:|     ..||||....:..|  |.:::..|..:|...:.:|.:.:.||.
  Fly     4 LIVFVALFAVALAAPAA-----EEPTIVRSESDVGP--ESFKYDWETSDGQAAQAVGQLNDIGTE 61

  Fly    71 DEQLVVMGMYSSYDEKTDTETVTMYTADKDGYK 103
            :|.:.|.|.|....:...|..|. |.|||:|::
  Fly    62 NEAISVSGSYRFIADDGQTYQVN-YIADKNGFQ 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15515NP_001263088.1 None
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.