DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15515 and l(3)mbn

DIOPT Version :9

Sequence 1:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:118 Identity:28/118 - (23%)
Similarity:46/118 - (38%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SAKLLLFTALVALMAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNP 67
            |.||:.|...:.|:.          ....::|......|.|.|:....::....||:|.|:||..
  Fly     2 SLKLMAFVCALLLLC----------TLTHVLSAATTVRPYKFGFTIDEQQHRAEKRDERGIIMGE 56

  Fly    68 G---TPDEQLVVMGMYSSYDEKTDTETVTMYTADKDGYKARYQIKNRKLSPGA 117
            .   |.|      |:|.          ||:|..|::|   :::|.:.|..|.|
  Fly    57 FGFITAD------GIYH----------VTVYATDEEG---KFRIISMKSYPYA 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15515NP_001263088.1 Chitin_bind_4 46..102 CDD:278791 14/58 (24%)
l(3)mbnNP_729143.2 Chitin_bind_4 31..77 CDD:278791 16/61 (26%)
Chitin_bind_4 575..621 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.