DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15515 and Cpr47Ef

DIOPT Version :10

Sequence 1:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:73 Identity:26/73 - (35%)
Similarity:37/73 - (50%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNPGTPDEQLVVMGMYSSYDEKTDTETVTM 94
            |..:..:.|:......|||:.|..||.|.:|.|.:.|.|:.:|...|||.| ||..........|
  Fly   133 PIPILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSY-SYTNPEGELVEIM 196

  Fly    95 YTADKDGY 102
            ||||::|:
  Fly   197 YTADENGF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15515NP_001263088.1 None
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 23/55 (42%)

Return to query results.
Submit another query.